⚡ This is your brand? Claim your page FREE and bring it to life on AI search.

AI Visibility Scorecard

depprock.com

depprock.com

Unclaimed

depprock.com · Other

At 2.8/10, depprock.com is close to invisible in AI search today. Most assistants will not cite it when asked about your category - fixable, and the signals below show exactly where to start.

AI engines read this profile 2 times

Claude · Apple Intelligence

2.8

/10

AEO Score

Share

About depprock.com

from our crawl and measurement

depprock.com is a business whose own site puts it this way: "Hoppa till innehåll amerikansktengelsktfransktsvenskttyskt depprock.com Sanningen om 2022 mars 1st, 2023 Tog ju sjukt lång tid att få till en årsbästalista för 2022." To AI engines like ChatGPT and Perplexity it is close to invisible, scoring 2.8 out of 10.

Our crawl found a sitemap and a readable heading structure. It is missing structured data describing the business and an llms.txt file.

AI crawlers have visited 2 times in our tracking, including ClaudeBot (Anthropic) and Applebot (Siri).

Industry · Other
Last scored · Aug 10, 2026

The 6 signals AI reads

Higher is better · 0-10

Structured Data

1

Organization / LocalBusiness JSON-LD that AI can read.

Content Structure

7

Clear headings and answer-style content.

Entity Clarity

3

How clearly your brand identity reads to AI.

E-E-A-T Signals

Experience, Expertise, Authority, Trust

0

Experience, Expertise, Authority, Trust markers.

Technical AEO

6

robots.txt, llms.txt, and AI-bot crawl access.

AI Discoverability

3

Sitemaps and entity links AI can follow.

Off-page authority

How the web signals your brand to AI

Backlinks

1

Inbound links from other sites.

Domain Authority

0

Little domain authority yet.

Reference Presence

0

Not in AI knowledge graphs yet.

News & Press

0

No press coverage found yet.

Community

0

No community discussion yet.

Social Mentions

0

No social discussion found yet.

What this score means

Your AEO score measures whether AI search engines - ChatGPT, Claude, Perplexity, Gemini - can actually read your site and cite it in answers. Roughly two-thirds of sites are invisible to them. At 2.8/10, depprock.com is crawlable but under-signaled - fixable, and the signals above are where to start.

Is this your brand?

The exact fixes for depprock.com

Which AI engines already crawl you

Weekly ChatGPT & Claude citation tracking

Already have an account? Sign in

Picked for depprock.com: AEO & AI Search

Why your brand doesn't show up in ChatGPT answers (and how to fix it)

ChatGPT doesn't crawl the web like Google does. When someone asks Claude about the best project management tools, the model isn't searching your website in real-time. It's pulling from training data that stopped months or years ago.

Continue reading in your free Engagemii portal

Free signup unlocks the full article plus your personalized AEO fix list for depprock.com.

Source & Attribution

Scored by Engagemii on August 10, 2026. Methodology: engagemii.com/aeo/methodology

Source URL: https://engagemii.com/aeo/brands/depprock

Cite this score: Engagemii (2026). "AEO Score for depprock.com." Retrieved from https://engagemii.com/aeo/brands/depprock

Licensed under CC BY 4.0. You may reuse this data with attribution: a visible link to engagemii.com.

Powered by Engagemii - The Answer Engine Optimization (AEO) Platform