⚡ This is your brand? Claim your page FREE and bring it to life on AI search.
AI Visibility Scorecard
keysolution.fr · Other
Borderline visible. AI bots can crawl KEYSOLUTION, but the structured-data signals are thin - you are at real risk of being skipped when buyers ask ChatGPT, Claude, or Perplexity for a recommendation.
Monitoring for AI engine activity
In the Engagemii AEO index
4.2
/10
AEO Score
from our crawl and measurement
KEYSOLUTION describes itself simply: "lemondeenstopbivouacresidomiaormanaofficialmarmitopenergycoldcrjesquadriaswintechgroupepices-millesaveurslequipe228padfaosworldcompanyaspamnewsamenageriecfdtdiviaclicinformatiqu...." When AI engines look at it, they find little to work with. It scores 4.2 out of 10.
The gap is on the page itself: the site is missing structured data describing the business, an llms.txt file, a sitemap, which are the first things an answer engine looks for.
Higher is better · 0-10
Structured Data
8
Organization / LocalBusiness JSON-LD that AI can read.
Content Structure
8
Clear headings and answer-style content.
Entity Clarity
6
How clearly your brand identity reads to AI.
E-E-A-T Signals
Experience, Expertise, Authority, Trust
3
Experience, Expertise, Authority, Trust markers.
Technical AEO
7
robots.txt, llms.txt, and AI-bot crawl access.
AI Discoverability
5
Sitemaps and entity links AI can follow.
How the web signals your brand to AI
Backlinks
0
No inbound links found yet.
Domain Trust
1
Established authority for your domain.
Entity Presence
0
Not in AI knowledge graphs yet.
News Mentions
0
No press coverage found yet.
Community
0
No community discussion yet.
0
No Reddit mentions found yet.
Your AEO score measures whether AI search engines - ChatGPT, Claude, Perplexity, Gemini - can actually read your site and cite it in answers. Roughly two-thirds of sites are invisible to them. At 4.2/10, KEYSOLUTION is crawlable but under-signaled - fixable, and the signals above are where to start.
Is this your brand?
The exact fixes for KEYSOLUTION
Which AI engines already crawl you
Weekly ChatGPT & Claude citation tracking
The search landscape has fundamentally shifted. While Google still dominates, millions of users now ask questions to ChatGPT, Gemini, and Claude instead of typing into a search bar.
Continue reading in your free Engagemii portalFree signup unlocks the full article plus your personalized AEO fix list for KEYSOLUTION.
Scored by Engagemii on July 31, 2026. Methodology: engagemii.com/aeo/methodology
Source URL: https://engagemii.com/aeo/brands/keysolution-fr
Cite this score: Engagemii (2026). "AEO Score for KEYSOLUTION." Retrieved from https://engagemii.com/aeo/brands/keysolution-fr
Licensed under CC BY 4.0. You may reuse this data with attribution: a visible link to engagemii.com.
Powered by Engagemii - The Answer Engine Optimization (AEO) Platform