⚡ This is your brand? Claim your page FREE and bring it to life on AI search.

AI Visibility Scorecard

KEYSOLUTION

KEYSOLUTION

Unclaimed

keysolution.fr · Other

Borderline visible. AI bots can crawl KEYSOLUTION, but the structured-data signals are thin - you are at real risk of being skipped when buyers ask ChatGPT, Claude, or Perplexity for a recommendation.

Monitoring for AI engine activity

In the Engagemii AEO index

4.2

/10

AEO Score

Share

About KEYSOLUTION

from our crawl and measurement

KEYSOLUTION describes itself simply: "lemondeenstopbivouacresidomiaormanaofficialmarmitopenergycoldcrjesquadriaswintechgroupepices-millesaveurslequipe228padfaosworldcompanyaspamnewsamenageriecfdtdiviaclicinformatiqu...." When AI engines look at it, they find little to work with. It scores 4.2 out of 10.

The gap is on the page itself: the site is missing structured data describing the business, an llms.txt file, a sitemap, which are the first things an answer engine looks for.

Industry · Other
Last scored · Jul 31, 2026

The 6 signals AI reads

Higher is better · 0-10

Structured Data

8

Organization / LocalBusiness JSON-LD that AI can read.

Content Structure

8

Clear headings and answer-style content.

Entity Clarity

6

How clearly your brand identity reads to AI.

E-E-A-T Signals

Experience, Expertise, Authority, Trust

3

Experience, Expertise, Authority, Trust markers.

Technical AEO

7

robots.txt, llms.txt, and AI-bot crawl access.

AI Discoverability

5

Sitemaps and entity links AI can follow.

Off-page authority

How the web signals your brand to AI

Backlinks

0

No inbound links found yet.

Domain Trust

1

Established authority for your domain.

Entity Presence

0

Not in AI knowledge graphs yet.

News Mentions

0

No press coverage found yet.

Community

0

No community discussion yet.

Reddit

0

No Reddit mentions found yet.

What this score means

Your AEO score measures whether AI search engines - ChatGPT, Claude, Perplexity, Gemini - can actually read your site and cite it in answers. Roughly two-thirds of sites are invisible to them. At 4.2/10, KEYSOLUTION is crawlable but under-signaled - fixable, and the signals above are where to start.

Is this your brand?

The exact fixes for KEYSOLUTION

Which AI engines already crawl you

Weekly ChatGPT & Claude citation tracking

Already have an account? Sign in

Picked for KEYSOLUTION: How-To

How to Get Your Brand Cited by ChatGPT, Gemini, and Claude: The Complete AEO Guide

The search landscape has fundamentally shifted. While Google still dominates, millions of users now ask questions to ChatGPT, Gemini, and Claude instead of typing into a search bar.

Continue reading in your free Engagemii portal

Free signup unlocks the full article plus your personalized AEO fix list for KEYSOLUTION.

Source & Attribution

Scored by Engagemii on July 31, 2026. Methodology: engagemii.com/aeo/methodology

Source URL: https://engagemii.com/aeo/brands/keysolution-fr

Cite this score: Engagemii (2026). "AEO Score for KEYSOLUTION." Retrieved from https://engagemii.com/aeo/brands/keysolution-fr

Licensed under CC BY 4.0. You may reuse this data with attribution: a visible link to engagemii.com.

Powered by Engagemii - The Answer Engine Optimization (AEO) Platform