50% off the $29.99 Custom Kit. Use at checkout:
⚡ This is your brand? Claim your page FREE and bring it to life on AI search.
AEO Score: 6/10
Monitoring for AI engine activity
In the Engagemii AEO index
#23,433 of 428,069 in Health & Wellness for AI visibility
Your AEO score measures whether AI search engines (ChatGPT, Claude, Perplexity, Gemini) can actually read your site and cite it in answers. Two-thirds of websites are invisible to them. Medspa and Wellness Clinic Therapy Lakeland Florida just got measured.
6/10 means Medspa and Wellness Clinic Therapy Lakeland Florida is somewhat visible. AI bots can read you, but you are missing the structured signals that would push citation rate above competitors.
Discover premium vitamin therapies, personalized wellness solutions including NAD therapy, peptide treatments, injectable vitamins, Medspa and Wellness Clinic, and Mind & Body Functional Labs at Serenity Mind & Body Solutions.
Industry: Health & Wellness
medspaandwellnesscliniclakelandfl.com2
Structured Data
8
Content Structure
7
Entity Clarity
3
E-E-A-T Signals
6
Technical AEO
6
AI Discoverability
Is this your brand?
Claim free. You'll see:
Your full 6-category score breakdown
Exact fixes: robots.txt, schema, llms.txt
AI bot crawls from ChatGPT, Claude, Perplexity, Gemini
Personal 50% off code at checkout
In health and wellness, you're not just selling a product. You're asking someone to trust you with their body.
Continue reading in your free Engagemii portalFree signup unlocks the full article plus your personalized AEO fix list for Medspa and Wellness Clinic Therapy Lakeland Florida.
Scored by Engagemii on July 16, 2026. Methodology: engagemii.com/aeo/methodology
Source URL: https://engagemii.com/aeo/brands/medspaandwellnesscliniclakelandfl
Cite this score: Engagemii (2026). "AEO Score for Medspa and Wellness Clinic Therapy Lakeland Florida." Retrieved from https://engagemii.com/aeo/brands/medspaandwellnesscliniclakelandfl
Licensed under CC BY 4.0. You may reuse this data with attribution: a visible link to engagemii.com.
Powered by Engagemii - The Answer Engine Optimization (AEO) Platform