⚡ This is your brand? Claim your page FREE and bring it to life on AI search.

AI Visibility Scorecard

mycryptosoccer

mycryptosoccer

Unclaimed

mycryptosoccer.com · Finance & Insurance

Borderline visible. AI bots can crawl mycryptosoccer, but the structured-data signals are thin - you are at real risk of being skipped when buyers ask ChatGPT, Claude, or Perplexity for a recommendation.

Monitoring for AI engine activity

In the Engagemii AEO index

#624,338 of 746,010 in Finance & Insurance for AI visibility

3.1

/10

AEO Score

Share

About mycryptosoccer

from our crawl and measurement

mycryptosoccer describes itself simply: "EngPorABOUTBLOG & NEWSNFTWHITEPAPERMARKETPLACEFAQJOIN USBOOST YOUR CLUB'S REVENUE.TURN FANS INTO LOYAL SUPPORTERS.Our service specializes in creating exclusive NFTs, turning them into." To AI engines like ChatGPT and Perplexity it is close to invisible, scoring 2.8 out of 10.

On the page it is passable on a workable page structure and partial sitemap and link coverage. What holds it back is a clearly stated business identity, the technical files AI engines look for, such as llms.txt or an open robots.txt, structured data describing the business and credibility markers like credentials or reviews.

Off the page, almost no other sites link to it, the domain does not yet read as established, AI engines do not yet recognise it as a distinct business, there is no press coverage to draw on, nobody is discussing it where AI engines look and it does not come up on Reddit. Those are earned elsewhere on the web, not fixed on the site itself.

The site links to no social profiles, so there is nothing tying the brand to a wider presence.

Industry · Finance & Insurance
Last scored · Aug 1, 2026

The 6 signals AI reads

Higher is better · 0-10

Structured Data

1

Organization / LocalBusiness JSON-LD that AI can read.

Content Structure

6

Clear headings and answer-style content.

Entity Clarity

3

How clearly your brand identity reads to AI.

E-E-A-T Signals

Experience, Expertise, Authority, Trust

2

Experience, Expertise, Authority, Trust markers.

Technical AEO

4

robots.txt, llms.txt, and AI-bot crawl access.

AI Discoverability

6

Sitemaps and entity links AI can follow.

Off-page authority

How the web signals your brand to AI

Backlinks

1

Inbound links from other sites.

Domain Authority

0

Little domain authority yet.

Reference Presence

0

Not in AI knowledge graphs yet.

News & Press

0

No press coverage found yet.

Community

0

No community discussion yet.

Social Mentions

0

No social discussion found yet.

What this score means

Your AEO score measures whether AI search engines - ChatGPT, Claude, Perplexity, Gemini - can actually read your site and cite it in answers. Roughly two-thirds of sites are invisible to them. At 3.1/10, mycryptosoccer is crawlable but under-signaled - fixable, and the signals above are where to start.

Is this your brand?

The exact fixes for mycryptosoccer

Which AI engines already crawl you

Weekly ChatGPT & Claude citation tracking

Already have an account? Sign in

Picked for mycryptosoccer: How-To

How to Get Your Brand Cited by ChatGPT, Gemini, and Claude: The Complete AEO Guide

The search landscape has fundamentally shifted. While Google still dominates, millions of users now ask questions to ChatGPT, Gemini, and Claude instead of typing into a search bar.

Continue reading in your free Engagemii portal

Free signup unlocks the full article plus your personalized AEO fix list for mycryptosoccer.

Source & Attribution

Scored by Engagemii on August 1, 2026. Methodology: engagemii.com/aeo/methodology

Source URL: https://engagemii.com/aeo/brands/mycryptosoccer

Cite this score: Engagemii (2026). "AEO Score for mycryptosoccer." Retrieved from https://engagemii.com/aeo/brands/mycryptosoccer

Licensed under CC BY 4.0. You may reuse this data with attribution: a visible link to engagemii.com.

Powered by Engagemii - The Answer Engine Optimization (AEO) Platform