⚡ This is your brand? Claim your page FREE and bring it to life on AI search.

AI Visibility Scorecard

Perfect Touch Auto Glass

Perfect Touch Auto Glass

Unclaimed

windshieldreplacementnewkentva.com · Other

At 1.2/10, Perfect Touch Auto Glass is close to invisible in AI search today. Most assistants will not cite it when asked about your category - fixable, and the signals below show exactly where to start.

AI engines read this profile 1 times

ChatGPT

1.2

/10

AEO Score

Share

About Perfect Touch Auto Glass

from our crawl and measurement

Perfect Touch Auto Glass is a business whose own site puts it this way: "Get fast and reliable mobile windshield replacement and calibration services in Henrico, VA. Click here!." To AI engines like ChatGPT and Perplexity it is close to invisible, scoring 0.9 out of 10.

Almost none of the machinery AI engines read is present, including structured data describing the business, an llms.txt file, a sitemap.

Industry · Other
Last scored · Jul 31, 2026

The 6 signals AI reads

Higher is better · 0-10

Structured Data

1

Organization / LocalBusiness JSON-LD that AI can read.

Content Structure

0

Clear headings and answer-style content.

Entity Clarity

3

How clearly your brand identity reads to AI.

E-E-A-T Signals

Experience, Expertise, Authority, Trust

0

Experience, Expertise, Authority, Trust markers.

Technical AEO

2

robots.txt, llms.txt, and AI-bot crawl access.

AI Discoverability

2

Sitemaps and entity links AI can follow.

Off-page authority

How the web signals your brand to AI

Backlinks

1

Inbound links from other sites.

Domain Authority

0

Little domain authority yet.

Reference Presence

0

Not in AI knowledge graphs yet.

News & Press

0

No press coverage found yet.

Community

0

No community discussion yet.

Social Mentions

0

No social discussion found yet.

What this score means

Your AEO score measures whether AI search engines - ChatGPT, Claude, Perplexity, Gemini - can actually read your site and cite it in answers. Roughly two-thirds of sites are invisible to them. At 1.2/10, Perfect Touch Auto Glass is crawlable but under-signaled - fixable, and the signals above are where to start.

Is this your brand?

The exact fixes for Perfect Touch Auto Glass

Which AI engines already crawl you

Weekly ChatGPT & Claude citation tracking

Already have an account? Sign in

Picked for Perfect Touch Auto Glass: AEO & AI Search

Why your brand doesn't show up in ChatGPT answers (and how to fix it)

ChatGPT doesn't crawl the web like Google does. When someone asks Claude about the best project management tools, the model isn't searching your website in real-time. It's pulling from training data that stopped months or years ago.

Continue reading in your free Engagemii portal

Free signup unlocks the full article plus your personalized AEO fix list for Perfect Touch Auto Glass.

Source & Attribution

Scored by Engagemii on July 31, 2026. Methodology: engagemii.com/aeo/methodology

Source URL: https://engagemii.com/aeo/brands/windshieldreplacementnewkentva

Cite this score: Engagemii (2026). "AEO Score for Perfect Touch Auto Glass." Retrieved from https://engagemii.com/aeo/brands/windshieldreplacementnewkentva

Licensed under CC BY 4.0. You may reuse this data with attribution: a visible link to engagemii.com.

Powered by Engagemii - The Answer Engine Optimization (AEO) Platform