⚡ This is your brand? Claim your page FREE and bring it to life on AI search.
AI Visibility Scorecard
directlinkactiveadaptsystem.shop · Technology
At 1.4/10, directlinkactiveadaptsystem.shop is close to invisible in AI search today. Most assistants will not cite it when asked about your category - fixable, and the signals below show exactly where to start.
Monitoring for AI engine activity
In the Engagemii AEO index
#2,694,039 of 2,708,729 in Technology for AI visibility
1.4
/10
AEO Score
from our crawl and measurement
directlinkactiveadaptsystem.shop is a business whose own site puts it this way: "has been recently registered with namecheap.com Want a domain name like this?." As far as answer engines are concerned it may as well not exist yet: 1.1 out of 10.
The site is missing structured data describing the business, an llms.txt file and a sitemap.
Higher is better · 0-10
Structured Data
1
Organization / LocalBusiness JSON-LD that AI can read.
Content Structure
3
Clear headings and answer-style content.
Entity Clarity
2
How clearly your brand identity reads to AI.
E-E-A-T Signals
Experience, Expertise, Authority, Trust
0
Experience, Expertise, Authority, Trust markers.
Technical AEO
1
robots.txt, llms.txt, and AI-bot crawl access.
AI Discoverability
2
Sitemaps and entity links AI can follow.
How the web signals your brand to AI
Backlinks
1
Inbound links from other sites.
Domain Trust
0
Little domain authority yet.
Entity Presence
0
Not in AI knowledge graphs yet.
News Mentions
0
No press coverage found yet.
Community
0
No community discussion yet.
0
No Reddit mentions found yet.
Your AEO score measures whether AI search engines - ChatGPT, Claude, Perplexity, Gemini - can actually read your site and cite it in answers. Roughly two-thirds of sites are invisible to them. At 1.4/10, directlinkactiveadaptsystem.shop is crawlable but under-signaled - fixable, and the signals above are where to start.
Is this your brand?
The exact fixes for directlinkactiveadaptsystem.shop
Which AI engines already crawl you
Weekly ChatGPT & Claude citation tracking
Tech buyers are the most research-intensive shoppers on the internet.
Continue reading in your free Engagemii portalFree signup unlocks the full article plus your personalized AEO fix list for directlinkactiveadaptsystem.shop.
Scored by Engagemii on August 10, 2026. Methodology: engagemii.com/aeo/methodology
Source URL: https://engagemii.com/aeo/brands/directlinkactiveadaptsystem-shop
Cite this score: Engagemii (2026). "AEO Score for directlinkactiveadaptsystem.shop." Retrieved from https://engagemii.com/aeo/brands/directlinkactiveadaptsystem-shop
Licensed under CC BY 4.0. You may reuse this data with attribution: a visible link to engagemii.com.
Powered by Engagemii - The Answer Engine Optimization (AEO) Platform