englishfluencyplan.com redirects to speakenglishwithtiffaniacademy.com. This page describes the site that domain now serves; the primary profile lives at speakenglishwithtiffaniacademy.com.
AI visibility score
1.5/ 10Weak

▲ 0.1 since Sep 2026

#92,438 of 93,209 in Membership Organizations

As of 2026-09-25 · Engagemii indexCheck another site →The index →

AI Visibility Scorecard

englishfluencyplan.com

englishfluencyplan.com

Unclaimed

englishfluencyplan.com · Membership Organizations

At 1.5/10, englishfluencyplan.com is close to invisible in AI search today. Most assistants will not cite it when asked about your category - fixable, and the signals below show exactly where to start.

Monitoring for AI engine activity

In the Engagemii AEO index

#92,438 of 93,209 in Membership Organizations for AI visibility

2

AEO Visibility

i

Near-invisible · 1.5/10

0

Muse Index Score

i

AI agent readiness

Not agent-ready · 0/100

0

AI Adoption

i

None detected · 0/100

Share

About englishfluencyplan.com

from our crawl and measurement

"Speak English Like A Native[Get on the waiting list] Finally take your English fluency to the next level I am amazed by how fast I have progressed using teacher Tiffani's logical methods." That is how Speak English Like A Native Membership introduces itself. As far as answer engines are concerned it may as well not exist yet: 1.5 out of 10.

The site is missing structured data describing the business, an llms.txt file and a sitemap.

Industry · Membership Organizations
Last scored · Sep 25, 2026

The 6 signals AI reads

Strong · Good · Fair · Weak

Structured Data

Weak

Organization / LocalBusiness JSON-LD that AI can read.

Content Structure

Weak

Clear headings and answer-style content.

Entity Clarity

Weak

How clearly your brand identity reads to AI.

E-E-A-T Signals

Experience, Expertise, Authority, Trust

Weak

Experience, Expertise, Authority, Trust markers.

Technical AEO

Weak

robots.txt, llms.txt, and AI-bot crawl access.

AI Discoverability

Weak

Sitemaps and entity links AI can follow.

Off-page authority

How the web signals your brand to AI

Backlinks

Weak

No inbound links found yet.

Domain Authority

Weak

Little domain authority yet.

Reference Presence

Weak

Not in AI knowledge graphs yet.

News & Press

Weak

No press coverage found yet.

Community

Weak

No community discussion yet.

Social Mentions

Weak

No social discussion found yet.

What this score means

Your AEO score measures whether AI search engines - ChatGPT, Claude, Perplexity, Gemini - can actually read your site and cite it in answers. Roughly two-thirds of sites are invisible to them. At 1.5/10, englishfluencyplan.com is crawlable but under-signaled - fixable, and the signals above are where to start.

Is this your brand?

✓

The exact fixes for englishfluencyplan.com

✓

Which AI engines already crawl you

✓

Free AI bot monitoring: see every AI crawler that visits you

Already have an account? Sign in

Picked for englishfluencyplan.com: AEO & AI Search

Why your brand doesn't show up in ChatGPT answers (and how to fix it)

ChatGPT doesn't crawl the web like Google does. When someone asks Claude about the best project management tools, the model isn't searching your website in real-time. It's pulling from training data that stopped months or years ago.

Continue reading in your free Engagemii portal

Free signup unlocks the full article plus your personalized AEO fix list for englishfluencyplan.com.

Source & Attribution

Scored by Engagemii on September 25, 2026. Methodology: engagemii.com/aeo/methodology

Source URL: https://engagemii.com/aeo/brands/englishfluencyplan

Cite this score: Engagemii (2026). "AEO Score for englishfluencyplan.com." Retrieved from https://engagemii.com/aeo/brands/englishfluencyplan

Licensed under CC BY 4.0. You may reuse this data with attribution: a visible link to engagemii.com.

Powered by Engagemii - The Answer Engine Optimization (AEO) Platform