letsjumprightin.com redirects to speakenglishwithtiffaniacademy.com. This page describes the site that domain now serves; the primary profile lives at speakenglishwithtiffaniacademy.com.
AI visibility score
3.2/ 10Weak

#861,499 of 937,188 in Education

As of 2026-08-17 · Engagemii indexCheck another site →The index →

AI Visibility Scorecard

letsjumprightin.com

letsjumprightin.com

Unclaimed

letsjumprightin.com · Education

Borderline visible. AI bots can crawl letsjumprightin.com, but the structured-data signals are thin - you are at real risk of being skipped when buyers ask ChatGPT, Claude, or Perplexity for a recommendation.

AI engines read this profile 1 times

Claude

#861,499 of 937,188 in Education for AI visibility

3

AEO Visibility

i

Near-invisible · 3.2/10

0

Muse Index Score

i

AI agent readiness

Not agent-ready · 0/100

0

AI Adoption

i

None detected · 0/100

Share

About letsjumprightin.com

from our crawl and measurement

365 Daily English Lessons (SINGLE) is one of the businesses we track in the Education space. When AI engines look at it, they find little to work with. It scores 3.2 out of 10.

The site is missing structured data describing the business, an llms.txt file and a sitemap.

Industry · Education
Last scored · Aug 17, 2026

The 6 signals AI reads

Strong · Good · Fair · Weak

Structured Data

Weak

Organization / LocalBusiness JSON-LD that AI can read.

Content Structure

Good

Clear headings and answer-style content.

Entity Clarity

Fair

How clearly your brand identity reads to AI.

E-E-A-T Signals

Experience, Expertise, Authority, Trust

Weak

Experience, Expertise, Authority, Trust markers.

Technical AEO

Good

robots.txt, llms.txt, and AI-bot crawl access.

AI Discoverability

Fair

Sitemaps and entity links AI can follow.

Off-page authority

How the web signals your brand to AI

Backlinks

Weak

No inbound links found yet.

Domain Authority

Weak

Little domain authority yet.

Reference Presence

Weak

Not in AI knowledge graphs yet.

News & Press

Weak

No press coverage found yet.

Community

Weak

No community discussion yet.

Social Mentions

Weak

No social discussion found yet.

What this score means

Your AEO score measures whether AI search engines - ChatGPT, Claude, Perplexity, Gemini - can actually read your site and cite it in answers. Roughly two-thirds of sites are invisible to them. At 3.2/10, letsjumprightin.com is crawlable but under-signaled - fixable, and the signals above are where to start.

Is this your brand?

✓

The exact fixes for letsjumprightin.com

✓

Which AI engines already crawl you

✓

Free AI bot monitoring: see every AI crawler that visits you

Already have an account? Sign in

Picked for letsjumprightin.com: How-To

How to Get Your Brand Cited by ChatGPT, Gemini, and Claude: The Complete AEO Guide

The search landscape has fundamentally shifted. While Google still dominates, millions of users now ask questions to ChatGPT, Gemini, and Claude instead of typing into a search bar.

Continue reading in your free Engagemii portal

Free signup unlocks the full article plus your personalized AEO fix list for letsjumprightin.com.

Source & Attribution

Scored by Engagemii on August 17, 2026. Methodology: engagemii.com/aeo/methodology

Source URL: https://engagemii.com/aeo/brands/letsjumprightin

Cite this score: Engagemii (2026). "AEO Score for letsjumprightin.com." Retrieved from https://engagemii.com/aeo/brands/letsjumprightin

Licensed under CC BY 4.0. You may reuse this data with attribution: a visible link to engagemii.com.

Powered by Engagemii - The Answer Engine Optimization (AEO) Platform