⚡ This is your brand? Claim your page FREE and bring it to life on AI search.

AI Visibility Scorecard

Auto Glass & Windshield Replacement | McKinney, TX
  
  Menu icon with three horizontal, equally spaced, black lines.

Auto Glass & Windshield Replacement | McKinney, TX Menu icon with three horizontal, equally spaced, black lines.

Unclaimed

windshieldreplacementmckinney.com · Automotive

Somewhat visible. AI bots can read Auto Glass & Windshield Replacement | McKinney, TX Menu icon with three horizontal, equally spaced, black lines., but it is missing the structured signals that push citation rate above competitors.

AI engines read this profile 2 times

Claude · Meta AI

#48,411 of 331,668 in Automotive for AI visibility

5.4

/10

AEO Score

Share

About Auto Glass & Windshield Replacement | McKinney, TX Menu icon with three horizontal, equally spaced, black lines.

from windshieldreplacementmckinney.com

Get expert auto glass & windshield replacement services. Enjoy same-day service & a lifetime warranty. Contact us today!

Industry · Automotive
Last scored · Aug 1, 2026

The 6 signals AI reads

Higher is better · 0-10

Structured Data

3

Organization / LocalBusiness JSON-LD that AI can read.

Content Structure

9

Clear headings and answer-style content.

Entity Clarity

9

How clearly your brand identity reads to AI.

E-E-A-T Signals

Experience, Expertise, Authority, Trust

6

Experience, Expertise, Authority, Trust markers.

Technical AEO

10

robots.txt, llms.txt, and AI-bot crawl access.

AI Discoverability

6

Sitemaps and entity links AI can follow.

Off-page authority

How the web signals your brand to AI

Backlinks

6

Inbound links from other sites.

Domain Authority

0

Little domain authority yet.

Reference Presence

0

Not in AI knowledge graphs yet.

News & Press

0

No press coverage found yet.

Community

0

No community discussion yet.

Social Mentions

0

No social discussion found yet.

What this score means

Your AEO score measures whether AI search engines - ChatGPT, Claude, Perplexity, Gemini - can actually read your site and cite it in answers. Roughly two-thirds of sites are invisible to them. At 5.4/10, Auto Glass & Windshield Replacement | McKinney, TX Menu icon with three horizontal, equally spaced, black lines. has a working base to build on - fixable, and the signals above are where to start.

Is this your brand?

The exact fixes for Auto Glass & Windshield Replacement | McKinney, TX Menu icon with three horizontal, equally spaced, black lines.

Which AI engines already crawl you

Weekly ChatGPT & Claude citation tracking

Already have an account? Sign in

Picked for Auto Glass & Windshield Replacement | McKinney, TX Menu icon with three horizontal, equally spaced, black lines.: How-To

How to Get Your Brand Cited by ChatGPT, Gemini, and Claude: The Complete AEO Guide

The search landscape has fundamentally shifted. While Google still dominates, millions of users now ask questions to ChatGPT, Gemini, and Claude instead of typing into a search bar.

Continue reading in your free Engagemii portal

Free signup unlocks the full article plus your personalized AEO fix list for Auto Glass & Windshield Replacement | McKinney, TX Menu icon with three horizontal, equally spaced, black lines..

Source & Attribution

Scored by Engagemii on August 1, 2026. Methodology: engagemii.com/aeo/methodology

Source URL: https://engagemii.com/aeo/brands/windshieldreplacementmckinney

Cite this score: Engagemii (2026). "AEO Score for Auto Glass & Windshield Replacement | McKinney, TX Menu icon with three horizontal, equally spaced, black lines.." Retrieved from https://engagemii.com/aeo/brands/windshieldreplacementmckinney

Licensed under CC BY 4.0. You may reuse this data with attribution: a visible link to engagemii.com.

Powered by Engagemii - The Answer Engine Optimization (AEO) Platform