⚡ This is your brand? Claim your page FREE and bring it to life on AI search.
AI Visibility Scorecard
windshieldreplacementmckinney.com · Automotive
Somewhat visible. AI bots can read Auto Glass & Windshield Replacement | McKinney, TX Menu icon with three horizontal, equally spaced, black lines., but it is missing the structured signals that push citation rate above competitors.
AI engines read this profile 2 times
Claude · Meta AI
#48,411 of 331,668 in Automotive for AI visibility
5.4
/10
AEO Score
from windshieldreplacementmckinney.com
Get expert auto glass & windshield replacement services. Enjoy same-day service & a lifetime warranty. Contact us today!
Higher is better · 0-10
Structured Data
3
Organization / LocalBusiness JSON-LD that AI can read.
Content Structure
9
Clear headings and answer-style content.
Entity Clarity
9
How clearly your brand identity reads to AI.
E-E-A-T Signals
Experience, Expertise, Authority, Trust
6
Experience, Expertise, Authority, Trust markers.
Technical AEO
10
robots.txt, llms.txt, and AI-bot crawl access.
AI Discoverability
6
Sitemaps and entity links AI can follow.
How the web signals your brand to AI
Backlinks
6
Inbound links from other sites.
Domain Authority
0
Little domain authority yet.
Reference Presence
0
Not in AI knowledge graphs yet.
News & Press
0
No press coverage found yet.
Community
0
No community discussion yet.
Social Mentions
0
No social discussion found yet.
Your AEO score measures whether AI search engines - ChatGPT, Claude, Perplexity, Gemini - can actually read your site and cite it in answers. Roughly two-thirds of sites are invisible to them. At 5.4/10, Auto Glass & Windshield Replacement | McKinney, TX Menu icon with three horizontal, equally spaced, black lines. has a working base to build on - fixable, and the signals above are where to start.
Is this your brand?
The exact fixes for Auto Glass & Windshield Replacement | McKinney, TX Menu icon with three horizontal, equally spaced, black lines.
Which AI engines already crawl you
Weekly ChatGPT & Claude citation tracking
The search landscape has fundamentally shifted. While Google still dominates, millions of users now ask questions to ChatGPT, Gemini, and Claude instead of typing into a search bar.
Continue reading in your free Engagemii portalFree signup unlocks the full article plus your personalized AEO fix list for Auto Glass & Windshield Replacement | McKinney, TX Menu icon with three horizontal, equally spaced, black lines..
Scored by Engagemii on August 1, 2026. Methodology: engagemii.com/aeo/methodology
Source URL: https://engagemii.com/aeo/brands/windshieldreplacementmckinney
Cite this score: Engagemii (2026). "AEO Score for Auto Glass & Windshield Replacement | McKinney, TX Menu icon with three horizontal, equally spaced, black lines.." Retrieved from https://engagemii.com/aeo/brands/windshieldreplacementmckinney
Licensed under CC BY 4.0. You may reuse this data with attribution: a visible link to engagemii.com.
Powered by Engagemii - The Answer Engine Optimization (AEO) Platform